코랩샵 KOLAB - 연구용 기자재, 실험용 기초 소모품 및 연구 장비 전문 쇼핑몰 메인
Q menu
오늘본상품
  • APE1/Ref-1 protein, Human recombinant
  • Z134661160, C20H16N8O3
  • Tetrahydrofuran, HPLC, 2.5 ℓ, CAS# 109-99-9
  • NIST, 2270, Perdeuterated PAH-II Solution in Hexane/Toluene, 5x1.2mL
  • TGA Pt Sample pan(100uL DTGA/Q5000) / TGA 백금 샘플팬(100uL DTGA/Q5000)
  • PTFE T-Type Connector / PTFE테프론T자형연결관
  • Ethyl Alcohol 99.9% (PE), GR, 1 ℓ, CAS# 64-17-5
  • Premium alumina crucible/lid set compare to Mettler ME 00024123 (70uL)/ Mettler 타입 70uL 알루미나 샘플팬&리드
  • Magnesium Nitrate hexahydrate, Extra Pure, 500 g, CAS# 13446-18-9
  • Flask, Round, With joint / 죠인트둥근플라스크
  • Inoculating Turntable / 턴 테이블
  • 100-1000ul Eppendorf-Type Tips/Racks
  • Bottle, Gas washing, With fritted disc / 휠타부착형가스세척병
  • Weighing Scoop / 평량스코프, Plastic Handle
  • Whatman™ Grade 42 Quantitative Filter Paper, 정량여과지
  • Millipore, 13mm Millex Syringe Filter, Hydrophilic PTFE, 시린지필터
  • Centrifuge Tube, Round Bottom / 플라스틱원심관
  • VS-302J, 303J, Shaker/ 진탕기
  • PTFE 2way bamboo shoot valves / PTFE2방밸브
  • 6N-Hydrochloric Acid (6M), Normal, 500 ㎖
  • 100-1000ul Filter Tips
  • TH3-E, Temperature Humidity Chamber, Basic/ 항온항습기 기본형
  • Pyrophosphoric acid, CP, 500 g, CAS# 2466-09-3
  • Syringe filter, Valuprep, Nylon membrane, 시린지필터
  • BD Difco™ Bottle Desoxycholate Agar 500G
  • 5-Neck Heavy-wall Round Bottom Flask / 5구헤비월환저플라스크
  • n-Heptane, Extra Pure, 1 ℓ, CAS# 142-82-5
  • IST, IST-R, Shaking Incubator (Tabletop) / 진탕 배양기, 탁상형
  • Acetone, BP, 18 ℓ, CAS# 67-64-1
  • VS-1203PFC, 1203PFC-L Multi-room Incubato/ 4실 저온 배양기
  • Methyl Alcohol, GR, 18 ℓ, CAS# 67-56-1
  • Spectrophotometer Easy UV/VIS/ 분광광도계, 3-in-1
  • 4inch Si Prime wafer (P Type, 1-10 ohm), Semi Flat, STC/ 4인치 실리콘 웨이퍼(P Type, 1-10 ohm), Semi Flat, STC
  • Sterlitech, cellQART® Cell Culture Inserts
  • DSC Premium pan compare to TA Instruments T Zero low mass / DSC샘플팬, T Zero low mass
  • 8-Hydroxyquinoline, Extra Pure, 500g, CAS# 148-24-3
  • Pipet Washer Set
  • Drawer Cabinet / 일체형부품박스
  • ASTM Serialized & Certified Volumetric Pipet / ASTM홀피펫, Class A + 개별 보증서
  • DURAN® Hi-grade General Purpose Desiccators with Knobbed Lid, id Φ100~300 mm without Plate, Borosilicate Glass 3.3 / 일반 데시케이터, 중판 별도
  • Serialized and Certified Measuring Cylinder, Kimble / ASTM메스실린더, Class A + USP 개별 보증서
  • 4inch Si Test wafer (P Type, 1-10ohm), Semi Flat, QL/ 4인치 실리콘 웨이퍼(P Type, 1-10ohm), Semi Flat, QL
  • PFA syringes / PFA주사기
  • Micro Sochlet Extractor / 미니쏙시렛추출장치, 25ml
  • Propyl Gallate, GR, 25 g, CAS# 121-79-9
  • Whatman™ Lens Cleaning Tissue
  • 100-1000ul Clear Tips/Racks / Wide Bore
  • HANDLE 조명라링고스쿠프핸들 150mm, 램프
  • APE1/Ref-1-Fc protein, Human, Recombinant
  • Condenser, Dewar type / 듀와냉각기
  • Butyl Acrylate, GR, 500 ㎖, CAS# 141-32-2
  • 96-well ELISA and Storage Sealing Mat / 96홀엘리사스토리지씰링매트
  • LCW-1300 Series / 기본형 중앙실험대
  • 디지털 진공게이지 (Testo552)
  • SPLScar™ Scratcher
  • Ammonium Iodide, Extra Pure, 500 g, CAS# 12027-06-4
  • Cuvette Cleaner, Cell Washer / 큐벳세척기
  • Ammonium Iron(III) Sulfate dodecahydrate, Extra Pure, 500 g, CAS# 7783-83-7
  • Sterlitech CA(Cellulose Acetate Membrane Filters / 셀룰로즈 아세테이트 멤브레인필터
  • 12 Bottom High Profile Reagent Reservoir / 12바텀하이프로필리저버
  • Automatic Buret, Dr. Schilling Pattern / 자동뷰렛, Class B
  • PFA Teflon Tweezer / 테프론트위저, Entegris,C01-0315
  • Burette, Micro, Double Teflon cock / 마이크로뷰렛, 더블테프론콕크
  • Amber Glass Wide Mouth Bottle / 광구병, with F217 Foam Lined
  • UV Satety Goggle / 자외선 차단 안경
  • F1-500MGS, Grade F1, 1mg~500mg Standard Weight Set/ 1mg~500mg 표준분동세트 (F1급)
  • Sodium N,N-diethyldithiocarbamate trihydrate, Extra Pure/AR, 25 g, CAS# 20624-25-3
  • Intravascular Polyethylene Tubing/ 혈관용 폴리에틸렌 튜빙
  • BULLDOG CLAMPS - 스프링불독클램프, 혈관감자 4.5cm 곡
  • Agilent 2ml Screw Vial Clear & Amber
  • Cargille, Refractive Index Liquids Sets - Series AA
  • WIEDER / TONGUR DEPRESSOR - 설압자 17cm
  • PFA vessels / PFA용기
  • IL-11, Low Temp. Incubator, 2-chambers, 4-chambers /저온 배양기 (강제 순환), 2챔버 4챔버
  • Multi-use Drawer Box / 조립식부품박스 (B)
  • Ultra Pure Water/ 초순수
  • Wafer Carrier Box / 웨이퍼캐리어박스
  • CONNIETOP, CT-WSC 코니탑 페액 안전 세트 , HPLC Waste Safety Set , HPLC 폐액통안전세트
  • Prethanol, FA, 18 ℓ, CAS# 64-17-5
  • Witeg® Glass Plug Burette, Class B, DINASO, 25 & 50ml With Amber-stain Graduation, Glass Cock 유리콕 뷰렛, 갈색눈금
  • Witeg® Premium Amber Round Bottom Flask, DURAN Glass, with ASTM Joint, 50~1,000ml Good for UV Protection, Made of Boroglass 3.3, Germany-Made> 갈색 조인트부 환저 플라스크
  • 포켓용 온습도계/ Testo610
  • Whatman™ Polyethersulfone Syringe Filter, Sterile / PES멸균시린지필터
  • Arsine generator / 비화수소발생장치
  • TLC Spotting Capillary Tube / TLC용모세관
  • GIGLE - 지그리 쏘우 40cm
  • IKA Multi-Position Magnetic Stirrer / 멀티자력교반기
  • Ammonium Molybdate tetrahydrate, GR, 25 g, CAS# 12054-85-2
  • THERMOSEL / 점도계 악세사리
  • Aluminum (Al) / 알루미늄
  • DURAN® Fernbach-type Culture Flasks, 450㎖ & 1800㎖ Made of Boro-glass 3.3, Standard Necks for 38mm Metal-caps, Fernbach / 컬춰 플라스크
  • 크린가드 청정마스크 50매, 44386(구 44296)
TOP

상품간략정보 및 구매기능

APE1/Ref-1 protein, Human recombinant

상품 선택옵션 1 개, 추가옵션 0 개

상품코드 17423580880589
제조사 MediRedox
판매사 (주)코리아사이언스
배송비결제 구매금액이 100,000원 이하인 경우 배송비 3,500원이 자동 결제됩니다.
창닫기

선택옵션

선택
[MR-RPAPE-010] APE1/Ref-1 protein, Human recombinant (0.1mg)  + 495,000원
위시리스트

관련상품

등록된 관련상품이 없습니다.

상품 정보

제품번호 Model 제품설명 Unit/규격 가격
(부가세포함)
수량 장바구니
MR-RPAPE-010 1. APE1/Ref-1 protein, Human recombinant (0.1mg) EA 소비자가 : 495,000원
(+0원)
← 좌우로 스크롤하여 더 많은 정보를 확인하세요 →




APE1/Ref-1 protein, Human recombinant 


Protein Gene nameAPEX1
Other nameAPE1/Ref-1, APEX1, APE1, Ref-1, HAP
NCBI Reference SequenceNM_001641.3
Cat.NoMR-RPAPE-010
AA SequenceMGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRDPNSMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPLYED
PPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLS
RQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNP
KGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDH
CPITLYLAL
Size0.1 mg
HostE. Coli
Form/ storage solutionSolution, containing 10mM Tris-HClpH8, 50mM Nacl, 1mM DTT, 0.05mM EDTA, 200 µg/ml BSA, 50% glycerol
Concentration1mg/ml
Protein FormFull Length, Recombinant
Protein Tag or FusionN-terminal His tag
Protein size39 kDa
Purity≥ 90% by SDS-PAGE
StorageShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles



 

References

• Korean Journal of Physiology and Pharmacology 2025 (PMID: 40051129)  
• Biomedicines 2022 (PMID: 35052869)  
• Journal of Clinical Medicine 2021 (PMID: 34830606)  
• Biomedicines 2021 (PMID: 34440244)  
• Biomedicines 2020 (PMID: 32967121