코랩샵 KOLAB - 연구용 기자재, 실험용 기초 소모품 및 연구 장비 전문 쇼핑몰 메인
Q menu
오늘본상품
  • APE1/Ref-1 protein, Human recombinant
  • NIST, 186g, pH Standards Potassium Dihydrogen Phosphate (186-I-g) Disodium Hydrogen Phosphate (186-II-g), set
  • NIST, 2112, Dynamic Impact Force Verification Specimens (Self-Verification, 8-mm Striker, 24 kN nominal), set
  • NIST, 2891, Ethanol-Water Solution (Nominal Mass Fraction 0.02 %) 5x1.2, mL
  • NIST, 640f, Line Position and Line Shape Standard for Powder Diffraction (Silicon Powder), 7.5g
  • NIST, 2163, Low Alloy Steel (chip form), 150g
  • NIST, 2830, Knoop Hardness of Ceramics, each
  • NIST, 2073a, Sinusoidal Roughness Specimen, each
  • NIST, 2099, Super-High-Energy Charpy V-Notch Specimens (Self-Verification, 8 mm Striker), set
  • NIST, 2817, Rockwell Hardness 15N Scale - Mid Range (Nominal 83 HR15N), 1block
  • Cargille, Refractive Index Liquids, Series E
  • NIST, 2942, Relative Intensity Correction Standard for Fluorescence Spectroscopy: Ultraviolet Emission, each
  • NIST, 1882a, Calcium Aluminate Cement, 4x5g
  • NIST, 2162, Low Alloy Steel (chip form), 150g
  • NIST, 4328d, Thorium-229 Radioactivity Standard, 5mL
  • Sodium Persulfate, Extra Pure, 500 g, CAS# 7775-27-1
  • NIST, 4288b, Technetium-99 Radioactivity Standard, 5mL
  • NIST, 1416, Aluminosilicate Glass for Liquidus Temperature, 250g
  • NIST, 2214, Isooctane Liquid Density, 4x5mL
  • NIST, 187f, Sodium Tetraborate Decahydrate (Borax) pH Standard, 30g
  • NIST, 674b, X-Ray Powder Diffraction Intensity Set (Quantitative Powder Diffraction Standard), 10g
  • Cell Culture Slide
  • NIST, 2821, Rockwell Hardness 30N Scale - High Range (Nominal 79 HR30N), 1block
  • NIST, 2246a, Relative Intensity Correction Standard for Raman Spectroscopy: 830 nm Excitation, each
  • NIST, 4342a, Thorium-230 Radioactivity Standard, 5mL
  • NIST, 4919I, Strontium-90 Radioactivity Standard, 5mL
  • Hand Held Refractometer, MASTER-50H / 휴대용 굴절계 MASTER-50H
  • NIST, 4326a, Polonium-209 Radioactivity Standard, 5mL
  • NIST, 2372a, Human DNA Quantitation Standard, 3x55μL
  • NIST, 4323c, Plutonium-238 Radioactivity Standard, 5mL
  • NIST, 4274, Holmium-166m Gamma-ray Emission Rate Standard, 5mL
  • NIST, 4341a, Neptunium-237 Radioactivity Standard, 5mL
  • NIST, 634a, Portland Cement, 100g
  • NIST, 2831, Vickers Hardness of Ceramics and Hardmetals, each
  • NIST, 1932, Fluorescein Solution, 3x2mL
  • NIST, 2201, Sodium Chloride (Ion-Selective), 125g
  • NIST, 1819a, Sulfur in Lubricating Base Oil, set(5)
  • NIST, 1880b, Portland Cement, 5x5g
  • NIST, 675, Line Position, Mica (XRD), 7.5g
  • Cargille, Refractive Index Liquids Sets - Series AA
  • NIST, 4226d, Nickel-63 Radioactivity Standard, 5mL
  • NIST, 363, Chromium-Vanadium Steel (Modified), 150g
  • NIST, 4416L, Gallium-67 Radioactivity Standard 5mL 5 MBq/g 3.3, May
  • NIST, 8393(QTY10), Human DNA for Whole-Genome Variant Assessment (Son of Chinese Ancestry)(HG-005) 10vials of, RM8393
  • NIST, 4330c, Plutonium-239 Radioactivity Standard, 3mL
  • NIST, 4337, Lead-210 Radioactivity Standard, 5mL
  • NIST, 1979, Powder Diffraction Line Profile Standard for Crystallite Size Analysis (Nano-Crystalline ZnO Powder), 2x3g
  • NIST, 4322d, Americium-241 Radioactivity Standard, 5mL
  • NIST, 2097, High-Energy Charpy V-Notch Specimens (Self-Verification, 8-mm Striker), set
  • NIST, 1884b, Portland Cement, 5x4.5g
  • NIST, 4926e, Hydrogen-3 Radioactivity Standard, 20mL
  • NIST, 13g, 0.6% Carbon Steel, 150g
  • NIST, 2113, Dynamic Impact Force Verification Specimens (Self-Verification, 8-mm Striker, 33 kN nominal), set
  • NIST, 2943, Relative Intensity Correction Standard for Fluorescence Spectroscopy: Blue Emission, each
  • NIST, 624, Lead-Silica Glass for dc Volume Resistivity, 200g
  • NIST, 1887b, Portland Cement, 5x4g
  • NIST, 2688, Portland Cement Clinker, 3x10g
  • NIST, 4417L, Indium-111 Radioactivity Standard 5mL 10 MBq/g 2.8, August
  • BS2, Heating Bath, Shaking/ 진탕 항온 수조
  • Hand Held Refractometer, MASTER-53Pα / 휴대용 굴절계 MASTER-53Pα
  • NIST, 4361c, Hydrogen-3 Radioactivity Standard, 500mL
  • NIST, 1881b, Portland Cement (Blended with Fly Ash), 5x5g
  • ATAGO, Digital Hand-Held Urine Specific Gravity, PEN-Urine S. G./ 휴대용 소변비중계 딥형 굴절계 (Dip Type)
  • NIST, 8398(QTY10), Human DNA for Whole-Genome Genome Variant Assessent (Daughter of Utah/European Ancestry) (HG-001) 10vials of, RM8398
  • NIST, 4404L, Thallium-201 Radioactivity Standard 5mL 10 MBq/g 3, June
  • NIST, 188, Potassium Hydrogen Tartrate (pH Standard), 60g
  • NIST, 1021, Glass Beads - Particle Size Distribution (2 μm to 12 μm diameter range), 4g
  • NIST, 361, AISI 4340 Steel (chip form), 150g
  • NIST, 4251d, Barium-133 Radioactivity Standard, 5mL
  • NIST, 185i, Potassium Hydrogen Phthalate, pH Standard, 60g
  • NIST, 4410H, Technetium-99m Radioactivity Standard 5mL 1.0 GBq/g 0.3, September
  • NIST, 2242a, Relative Intensity Correction Standard for Raman Spectroscopy: 532 nm Excitation, each
  • NIST, 4340b, Plutonium-241 Radioactivity Standard, 5mL
  • Hand Held Refractometer, MASTER-53PT / 휴대용 굴절계 MASTER-53PT
  • NIST, 4239a, Strontium-90 Radioactivity Standard, 5mL
  • NIST, 4915f, Cobalt-60 Radioactivity Standard, 5mL
  • NIST, 4321d, Natural Uranium Radioactivity Standard, 5mL
  • NIST, 616, Trace Elements in Glass, 4wafers
  • NIST, 2940a, Relative Intensity Correction Standard for Fluorescence Spectroscopy: Orange Emission, each
  • NIST, 1978, Particles Size Distribution Standard for Gravity Sedimentation, 5g
  • NIST, 4334j, Plutonium-242 Radioactivity Standard, 5mL
  • NIST, 4412L, Molybdenum-99 Radioactivity Standard 5mL 10 MBq/g 2.74, April
  • NIST, 2812, Rockwell C Scale Hardness - High Range, 1block
  • NIST, 2941a, Relative Intensity Correction Standard for Fluorescence Spectroscopy: Green Emission, each
  • NIST, 4339b, Radium-228 Radioactivity Standard, 5mL
TOP

상품간략정보 및 구매기능

APE1/Ref-1 protein, Human recombinant

상품 선택옵션 1 개, 추가옵션 0 개

상품코드 17423580880589
제조사 MediRedox
판매사 (주)코리아사이언스
배송비결제 구매금액이 100,000원 이하인 경우 배송비 3,500원이 자동 결제됩니다.
창닫기

선택옵션

선택
[MR-RPAPE-010] APE1/Ref-1 protein, Human recombinant (0.1mg)  + 495,000원
위시리스트

관련상품

등록된 관련상품이 없습니다.

상품 정보

그룹명 제품번호 Model 제품설명 Unit/규격 가격
(부가세포함)
수량 장바구니
MR-RPAPE-010 1. APE1/Ref-1 protein, Human recombinant (0.1mg) EA 소비자가 : 495,000원
(+0원)
← 좌우로 스크롤하여 더 많은 정보를 확인하세요 →




APE1/Ref-1 protein, Human recombinant 


Protein Gene nameAPEX1
Other nameAPE1/Ref-1, APEX1, APE1, Ref-1, HAP
NCBI Reference SequenceNM_001641.3
Cat.NoMR-RPAPE-010
AA SequenceMGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRDPNSMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPLYED
PPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLS
RQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNP
KGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDH
CPITLYLAL
Size0.1 mg
HostE. Coli
Form/ storage solutionSolution, containing 10mM Tris-HClpH8, 50mM Nacl, 1mM DTT, 0.05mM EDTA, 200 µg/ml BSA, 50% glycerol
Concentration1mg/ml
Protein FormFull Length, Recombinant
Protein Tag or FusionN-terminal His tag
Protein size39 kDa
Purity≥ 90% by SDS-PAGE
StorageShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles



 

References

• Korean Journal of Physiology and Pharmacology 2025 (PMID: 40051129)  
• Biomedicines 2022 (PMID: 35052869)  
• Journal of Clinical Medicine 2021 (PMID: 34830606)  
• Biomedicines 2021 (PMID: 34440244)  
• Biomedicines 2020 (PMID: 32967121